Lineage for d1lg1a1 (1lg1 A:22-266,A:335-386)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.5: Type II chitinase [51534] (11 proteins)
glycosylase family 18
Protein Chitotriosidase [82251] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82252] (2 PDB entries) 
Domain d1lg1a1: 1lg1 A:22-266,A:335-386 [77948]
Other proteins in same PDB: d1lg1a2
complexed with nag
Details for d1lg1a1
PDB Entry: 1lg1 (more details), 2.78 Å
PDB Description: crystal structure of human chitotriosidase in complex with chitobiose
SCOP Domain Sequences for d1lg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lg1a1 c.1.8.5 (A:22-266,A:335-386) Chitotriosidase {Human (Homo sapiens)}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels
SCOP Domain Coordinates for d1lg1a1:
Click to download the PDB-style file with coordinates for d1lg1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lg1a1:
- d1lg1a1 is new in SCOP 1.63
- d1lg1a1 appears in SCOP 1.65
- d1lg1a1 appears in the current release, SCOPe 2.08
View in 3D
