SCOP 1.71: Domain d1lfwa2: 1lfw A:187-382

Lineage for d1lfwa2 (1lfw A:187-382)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (6 proteins)

6. Protein Aminopeptidase PepV [82685] (1 species)
   contains insert sudbomain 205-292 mimicking the other half of the family-specific dimer

7. Species Lactobacillus delbrueckii [82686] (1 PDB entry)

8. Domain d1lfwa2: 1lfw A:187-382 [77943]
   Other proteins in same PDB: d1lfwa1
   complexed with aep, zn

Details for d1lfwa2

PDB Entry: 1lfw, 1.8 Å

PDB Description: Crystal structure of pepV

SCOP Domain Sequences for d1lfwa2:

Sequence; same for both SEQRES and ATOM records:

>d1lfwa2 d.58.19.1 (A:187-382) Aminopeptidase PepV {Lactobacillus delbrueckii}
qgiftlefsfknddtkgdyvldkfkagiatnvtpqvtratisgpdleavklayesfladk
eldgsfeindesadivligqgahasapqvgknsatflalfldqyafagrdknflhflaev
ehedfygkklgifhhddlmgdlasspsmfdyehagkasllnnvrypqgtdpdtmikqvld
kfsgildvtyngfeep

Timeline for d1lfwa2:

• d1lfwa2 first appeared in SCOP 1.63
  
• d1lfwa2 appears in SCOP 1.69
  
• d1lfwa2 appears in SCOP 1.73
  
• d1lfwa2 appears in the current release, SCOPe 2.08