Lineage for d1lfka_ (1lfk A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216631Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 216632Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 216633Family a.104.1.1: Cytochrome P450 [48265] (12 proteins)
  6. 216767Protein p450 monoxygenase OxyB [81863] (1 species)
    implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis
  7. 216768Species Amycolatopsis orientalis [TaxId:31958] [81864] (3 PDB entries)
  8. 216769Domain d1lfka_: 1lfk A: [77926]
    complexed with hem

Details for d1lfka_

PDB Entry: 1lfk (more details), 1.7 Å

PDB Description: crystal structure of oxyb, a cytochrome p450 implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis

SCOP Domain Sequences for d1lfka_:

Sequence, based on SEQRES records: (download)

>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis}
dprplhirrqgldpadellaagaltrvtigsgadaethwmatahavvrqvmgdhqqfstr
rrwdprdeiggkgifrprelvgnlmdydppehtrlrrkltpgftlrkmqrmapyieqivn
drldemeragspadliafvadkvpgavlcelvgvprddrdmfmklchghldaslsqkrra
algdkfsryllamiarerkepgegmigavvaeygddatdeelrgfcvqvmlagddnisgm
iglgvlamlrhpeqidafrgdeqsaqravdeliryltvpysptpriaredltlagqeikk
gdsvicslpaanrdpalapdvdrldvtrepiphvafghgvhhclgaalarlelrtvftel
wrrfpalrladpaqdtefrlttpaygltelmvaw

Sequence, based on observed residues (ATOM records): (download)

>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis}
dprplhirrqgldpadellaagaltrvtaethwmatahavvrqvmgdhqqfstrrrwdpe
lvgnlmdydppehtrlrrkltpgftlrkmqrmapyieqivndrldemeragspadliafv
adkvpgavlcelvgvprddrdmfmklchghldaslsqkrraalgdkfsryllamiarerk
epgegmigavvaeygddatdeelrgfcvqvmlagddnisgmiglgvlamlrhpeqidafr
gdeqsaqravdeliryltvpysptpriaredltlagqeikkgdsvicslpaanrdpalap
dvdrldvtrepiphvafghgvhhclgaalarlelrtvftelwrrfpalrladpaqdtefr
lttpaygltelmvaw

SCOP Domain Coordinates for d1lfka_:

Click to download the PDB-style file with coordinates for d1lfka_.
(The format of our PDB-style files is described here.)

Timeline for d1lfka_: