![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins) overall domain organization is similar to Lactobacillus maltose phosphorylase |
![]() | Protein Bacterial glucoamylase, N-terminal domain [82043] (1 species) |
![]() | Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [82044] (2 PDB entries) |
![]() | Domain d1lf9b2: 1lf9 B:11-287 [77925] Other proteins in same PDB: d1lf9a1, d1lf9b1 complexed with acr, so4 |
PDB Entry: 1lf9 (more details), 2.2 Å
SCOPe Domain Sequences for d1lf9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lf9b2 b.30.5.5 (B:11-287) Bacterial glucoamylase, N-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf gqsdseaaktaletlgedynnlknnyidewtkycntl
Timeline for d1lf9b2: