Lineage for d1lf9b2 (1lf9 B:11-287)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 461041Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
  6. 461042Protein Bacterial glucoamylase, N-terminal domain [82043] (1 species)
  7. 461043Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [82044] (2 PDB entries)
  8. 461047Domain d1lf9b2: 1lf9 B:11-287 [77925]
    Other proteins in same PDB: d1lf9a1, d1lf9b1

Details for d1lf9b2

PDB Entry: 1lf9 (more details), 2.2 Å

PDB Description: crystal structure of bacterial glucoamylase complexed with acarbose

SCOP Domain Sequences for d1lf9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf9b2 b.30.5.5 (B:11-287) Bacterial glucoamylase, N-terminal domain {Thermoanaerobacterium thermosaccharolyticum}
sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
gqsdseaaktaletlgedynnlknnyidewtkycntl

SCOP Domain Coordinates for d1lf9b2:

Click to download the PDB-style file with coordinates for d1lf9b2.
(The format of our PDB-style files is described here.)

Timeline for d1lf9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lf9b1