SCOPe 2.02: Domain d1lf9b1: 1lf9 B:288-684

Lineage for d1lf9b1 (1lf9 B:288-684)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.5: Bacterial glucoamylase C-terminal domain-like [81850] (2 proteins)
   overall domain organization is similar to Lactobacillus maltose phosphorylase

6. Protein Bacterial glucoamylase, C-terminal domain [81851] (1 species)

7. Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [81852] (2 PDB entries)

8. Domain d1lf9b1: 1lf9 B:288-684 [77924]
   Other proteins in same PDB: d1lf9a2, d1lf9b2
   complexed with acr, so4

Details for d1lf9b1

PDB Entry: 1lf9, 2.2 Å

PDB Description: crystal structure of bacterial glucoamylase complexed with acarbose

PDB Compounds: (B:) glucoamylase

SCOPe Domain Sequences for d1lf9b1:

Sequence; same for both SEQRES and ATOM records:

>d1lf9b1 a.102.1.5 (B:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
nnfngkanslyynsmmilkasedktnkgayiaslsipwgdgqrddntggyhlvwsrdlyh
vanafiaagdvdsanrsldylakvvkdngmipqntwisgkpywtgiqldeqadpiilsyr
lkrydlydslvkpladfiikigpktgqerweeiggyspatmaaevagltcaayiaeqnkd
yesaqkyqekadnwqklidnltytengplgngqyyiriaglsdpdadfminiangggvyd
qkeivdpsflelvrlgvksaddpkilntlkvvdstikvdtpkgpswyrynhdgygepskt
elyhgagkgrlwplltgergmyeiaagkdatpyvkamekfaneggiiseqvwedtglptd
sasplnwahaeyvilfasniehkvldmpdivykryva

Timeline for d1lf9b1:

• d1lf9b1 first appeared in SCOP 1.63
  
• d1lf9b1 appears in SCOPe 2.01
  
• d1lf9b1 appears in SCOPe 2.03
  
• d1lf9b1 appears in the current release, SCOPe 2.08