SCOPe 2.07: Domain d1lf6b2: 1lf6 B:11-287

Lineage for d1lf6b2 (1lf6 B:11-287)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins)
   overall domain organization is similar to Lactobacillus maltose phosphorylase
   automatically mapped to Pfam PF09137

6. Protein Bacterial glucoamylase, N-terminal domain [82043] (1 species)

7. Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [82044] (2 PDB entries)

8. Domain d1lf6b2: 1lf6 B:11-287 [77921]
   Other proteins in same PDB: d1lf6a1, d1lf6b1
   complexed with so4

Details for d1lf6b2

PDB Entry: 1lf6, 2.1 Å

PDB Description: crystal structure of bacterial glucoamylase

PDB Compounds: (B:) glucoamylase

SCOPe Domain Sequences for d1lf6b2:

Sequence; same for both SEQRES and ATOM records:

>d1lf6b2 b.30.5.5 (B:11-287) Bacterial glucoamylase, N-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
gqsdseaaktaletlgedynnlknnyidewtkycntl

Timeline for d1lf6b2:

• d1lf6b2 first appeared in SCOP 1.63
  
• d1lf6b2 appears in SCOPe 2.06
  
• d1lf6b2 appears in the current release, SCOPe 2.08