Lineage for d1lf6b2 (1lf6 B:11-287)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295197Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 295253Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 295462Family b.30.5.5: Bacterial glucoamylase, N-terminal domain [82042] (1 protein)
    overall domain organisation is similar to Lactobacillus maltose phosphorylase
  6. 295463Protein Bacterial glucoamylase, N-terminal domain [82043] (1 species)
  7. 295464Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [82044] (2 PDB entries)
  8. 295466Domain d1lf6b2: 1lf6 B:11-287 [77921]
    Other proteins in same PDB: d1lf6a1, d1lf6b1
    complexed with so4

Details for d1lf6b2

PDB Entry: 1lf6 (more details), 2.1 Å

PDB Description: crystal structure of bacterial glucoamylase

SCOP Domain Sequences for d1lf6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf6b2 b.30.5.5 (B:11-287) Bacterial glucoamylase, N-terminal domain {Thermoanaerobacterium thermosaccharolyticum}
sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
gqsdseaaktaletlgedynnlknnyidewtkycntl

SCOP Domain Coordinates for d1lf6b2:

Click to download the PDB-style file with coordinates for d1lf6b2.
(The format of our PDB-style files is described here.)

Timeline for d1lf6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lf6b1