Lineage for d1lf6b1 (1lf6 B:288-684)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722233Family a.102.1.5: Bacterial glucoamylase C-terminal domain-like [81850] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
  6. 2722234Protein Bacterial glucoamylase, C-terminal domain [81851] (1 species)
  7. 2722235Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [81852] (2 PDB entries)
  8. 2722239Domain d1lf6b1: 1lf6 B:288-684 [77920]
    Other proteins in same PDB: d1lf6a2, d1lf6b2
    complexed with so4

Details for d1lf6b1

PDB Entry: 1lf6 (more details), 2.1 Å

PDB Description: crystal structure of bacterial glucoamylase
PDB Compounds: (B:) glucoamylase

SCOPe Domain Sequences for d1lf6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf6b1 a.102.1.5 (B:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
nnfngkanslyynsmmilkasedktnkgayiaslsipwgdgqrddntggyhlvwsrdlyh
vanafiaagdvdsanrsldylakvvkdngmipqntwisgkpywtgiqldeqadpiilsyr
lkrydlydslvkpladfiikigpktgqerweeiggyspatmaaevagltcaayiaeqnkd
yesaqkyqekadnwqklidnltytengplgngqyyiriaglsdpdadfminiangggvyd
qkeivdpsflelvrlgvksaddpkilntlkvvdstikvdtpkgpswyrynhdgygepskt
elyhgagkgrlwplltgergmyeiaagkdatpyvkamekfaneggiiseqvwedtglptd
sasplnwahaeyvilfasniehkvldmpdivykryva

SCOPe Domain Coordinates for d1lf6b1:

Click to download the PDB-style file with coordinates for d1lf6b1.
(The format of our PDB-style files is described here.)

Timeline for d1lf6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lf6b2