Lineage for d1lf6a2 (1lf6 A:11-287)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781958Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
    automatically mapped to Pfam PF09137
  6. 2781959Protein Bacterial glucoamylase, N-terminal domain [82043] (1 species)
  7. 2781960Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [82044] (2 PDB entries)
  8. 2781963Domain d1lf6a2: 1lf6 A:11-287 [77919]
    Other proteins in same PDB: d1lf6a1, d1lf6b1
    complexed with so4

Details for d1lf6a2

PDB Entry: 1lf6 (more details), 2.1 Å

PDB Description: crystal structure of bacterial glucoamylase
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d1lf6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf6a2 b.30.5.5 (A:11-287) Bacterial glucoamylase, N-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
gqsdseaaktaletlgedynnlknnyidewtkycntl

SCOPe Domain Coordinates for d1lf6a2:

Click to download the PDB-style file with coordinates for d1lf6a2.
(The format of our PDB-style files is described here.)

Timeline for d1lf6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lf6a1