Lineage for d1lf4a_ (1lf4 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672681Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 672682Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (16 PDB entries)
  8. 672692Domain d1lf4a_: 1lf4 A: [77916]

Details for d1lf4a_

PDB Entry: 1lf4 (more details), 1.9 Å

PDB Description: structure of plasmepsin ii
PDB Compounds: (A:) Plasmepsin 2

SCOP Domain Sequences for d1lf4a_:

Sequence, based on SEQRES records: (download)

>d1lf4a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvik
vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
filgdpfmrkyftvfdydnhsvgialakknl

Sequence, based on observed residues (ATOM records): (download)

>d1lf4a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvif
yvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdp
fmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1lf4a_:

Click to download the PDB-style file with coordinates for d1lf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1lf4a_: