Lineage for d1lf2a_ (1lf2 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672681Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 672682Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (16 PDB entries)
  8. 672687Domain d1lf2a_: 1lf2 A: [77914]
    complexed with r37

Details for d1lf2a_

PDB Entry: 1lf2 (more details), 1.8 Å

PDB Description: crystal structure of plasmepsin ii from p falciparum in complex with inhibitor rs370
PDB Compounds: (A:) Plasmepsin 2

SCOP Domain Sequences for d1lf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf2a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1lf2a_:

Click to download the PDB-style file with coordinates for d1lf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1lf2a_: