Lineage for d1lelb_ (1lel B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232728Fold b.61: Streptavidin-like [50875] (5 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 232729Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 232730Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 232731Protein Avidin [50880] (1 species)
  7. 232732Species Chicken (Gallus gallus) [TaxId:9031] [50881] (9 PDB entries)
  8. 232750Domain d1lelb_: 1lel B: [77910]
    complexed with bh7, nag

Details for d1lelb_

PDB Entry: 1lel (more details), 2.9 Å

PDB Description: the avidin bcap complex

SCOP Domain Sequences for d1lelb_:

Sequence, based on SEQRES records: (download)

>d1lelb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d1lelb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttaeikesplhgtentinkrtqptfgftv
nwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOP Domain Coordinates for d1lelb_:

Click to download the PDB-style file with coordinates for d1lelb_.
(The format of our PDB-style files is described here.)

Timeline for d1lelb_: