SCOPe 2.07: Domain d1lela_: 1lel A:

Lineage for d1lela_ (1lel A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)

8. Domain d1lela_: 1lel A: [77909]
   complexed with bh7, ndg

Details for d1lela_

PDB Entry: 1lel, 2.9 Å

PDB Description: the avidin bcap complex

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1lela_:

Sequence, based on SEQRES records:

>d1lela_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records):

>d1lela_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttakesplhgtentinkrtqptfgftvnw
kfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Timeline for d1lela_:

• d1lela_ first appeared in SCOP 1.63
  
• d1lela_ appears in SCOPe 2.06
  
• d1lela_ appears in the current release, SCOPe 2.08