Lineage for d1lela_ (1lel A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073250Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2073251Protein Avidin [50880] (1 species)
  7. 2073252Species Chicken (Gallus gallus) [TaxId:9031] [50881] (12 PDB entries)
  8. 2073274Domain d1lela_: 1lel A: [77909]
    complexed with bh7, ndg

Details for d1lela_

PDB Entry: 1lel (more details), 2.9 Å

PDB Description: the avidin bcap complex
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1lela_:

Sequence, based on SEQRES records: (download)

>d1lela_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d1lela_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttakesplhgtentinkrtqptfgftvnw
kfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOPe Domain Coordinates for d1lela_:

Click to download the PDB-style file with coordinates for d1lela_.
(The format of our PDB-style files is described here.)

Timeline for d1lela_: