Lineage for d1leea_ (1lee A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563562Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 563563Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (8 PDB entries)
  8. 563570Domain d1leea_: 1lee A: [77908]
    complexed with r36

Details for d1leea_

PDB Entry: 1lee (more details), 1.9 Å

PDB Description: crystal structure of plasmepsin from p. falciparum in complex with inhibitor rs367

SCOP Domain Sequences for d1leea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leea_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
filgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1leea_:

Click to download the PDB-style file with coordinates for d1leea_.
(The format of our PDB-style files is described here.)

Timeline for d1leea_: