Lineage for d1ldqb_ (1ldq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805789Protein Avidin [50880] (1 species)
  7. 2805790Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)
  8. 2805809Domain d1ldqb_: 1ldq B: [77907]
    complexed with nag, shm

Details for d1ldqb_

PDB Entry: 1ldq (more details), 2.7 Å

PDB Description: avidin-homobiotin complex
PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1ldqb_:

Sequence, based on SEQRES records: (download)

>d1ldqb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d1ldqb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttaesplhgtentinkrtqptfgftvnwk
fsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOPe Domain Coordinates for d1ldqb_:

Click to download the PDB-style file with coordinates for d1ldqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ldqb_: