Lineage for d1ldqa_ (1ldq A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674119Protein Avidin [50880] (1 species)
  7. 674120Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 674133Domain d1ldqa_: 1ldq A: [77906]

Details for d1ldqa_

PDB Entry: 1ldq (more details), 2.7 Å

PDB Description: avidin-homobiotin complex
PDB Compounds: (A:) Avidin

SCOP Domain Sequences for d1ldqa_:

Sequence, based on SEQRES records: (download)

>d1ldqa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqpt
fgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Sequence, based on observed residues (ATOM records): (download)

>d1ldqa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttaikesplhgtentinkrtqptfgftvnw
kfsesttvftgqcfidgkevlktmwllrssvndigddwkatrvginiftrl

SCOP Domain Coordinates for d1ldqa_:

Click to download the PDB-style file with coordinates for d1ldqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ldqa_: