SCOPe 2.08: Domain d1ldob_: 1ldo B:

Lineage for d1ldob_ (1ldo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)

8. Domain d1ldob_: 1ldo B: [77905]
   complexed with nag, snr

Details for d1ldob_

PDB Entry: 1ldo, 2.2 Å

PDB Description: avidin-norbioitn complex

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1ldob_:

Sequence; same for both SEQRES and ATOM records:

>d1ldob_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d1ldob_:

• d1ldob_ first appeared in SCOP 1.63
  
• d1ldob_ appears in SCOPe 2.07