Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Avidin [50880] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries) |
Domain d1ldob_: 1ldo B: [77905] complexed with nag, snr |
PDB Entry: 1ldo (more details), 2.2 Å
SCOPe Domain Sequences for d1ldob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldob_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]} kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr l
Timeline for d1ldob_: