Lineage for d1ldoa_ (1ldo A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564717Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 564718Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 564719Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 564720Protein Avidin [50880] (1 species)
  7. 564721Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 564728Domain d1ldoa_: 1ldo A: [77904]

Details for d1ldoa_

PDB Entry: 1ldo (more details), 2.2 Å

PDB Description: avidin-norbioitn complex

SCOP Domain Sequences for d1ldoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldoa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOP Domain Coordinates for d1ldoa_:

Click to download the PDB-style file with coordinates for d1ldoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ldoa_: