Lineage for d1ldoa_ (1ldo A:)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.61: Streptavidin-like [50875] (5 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (1 family) 
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) 
Protein Avidin [50880] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50881] (9 PDB entries) 
Domain d1ldoa_: 1ldo A: [77904]
Details for d1ldoa_
PDB Entry: 1ldo (more details), 2.2 Å
PDB Description: avidin-norbioitn complex
SCOP Domain Sequences for d1ldoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldoa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l
SCOP Domain Coordinates for d1ldoa_:
Click to download the PDB-style file with coordinates for d1ldoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldoa_:
- d1ldoa_ is new in SCOP 1.63
- d1ldoa_ appears in SCOP 1.65
- d1ldoa_ appears in the current release, SCOPe 2.08
View in 3D
