Lineage for d1ld5a_ (1ld5 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032543Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)
  7. 3032544Species Human (Homo sapiens) [TaxId:9606] [57367] (6 PDB entries)
  8. 3032549Domain d1ld5a_: 1ld5 A: [77902]
    mutant

Details for d1ld5a_

PDB Entry: 1ld5 (more details)

PDB Description: structure of bpti mutant a16v
PDB Compounds: (A:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1ld5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld5a_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]}
rpdfcleppytgpcrvriiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1ld5a_:

Click to download the PDB-style file with coordinates for d1ld5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ld5a_: