Lineage for d1ld4d_ (1ld4 D:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433074Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 433075Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 433076Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 433204Protein Structural proteins [82946] (1 species)
  7. 433205Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry)
  8. 433209Domain d1ld4d_: 1ld4 D: [77889]

Details for d1ld4d_

PDB Entry: 1ld4 (more details)

PDB Description: placement of the structural proteins in sindbis virus

SCOP Domain Sequences for d1ld4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld4d_ i.6.1.1 (D:) Structural proteins {Sindbis virus}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1ld4d_:

Click to download the PDB-style file with coordinates for d1ld4d_.
(The format of our PDB-style files is described here.)

Timeline for d1ld4d_: