Lineage for d1ld4b_ (1ld4 B:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 754871Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 754872Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 754873Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 755018Protein Structural proteins [82946] (1 species)
  7. 755019Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry)
  8. 755021Domain d1ld4b_: 1ld4 B: [77887]

Details for d1ld4b_

PDB Entry: 1ld4 (more details)

PDB Description: placement of the structural proteins in sindbis virus
PDB Compounds: (B:) coat protein c

SCOP Domain Sequences for d1ld4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld4b_ i.6.1.1 (B:) Structural proteins {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1ld4b_:

Click to download the PDB-style file with coordinates for d1ld4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ld4b_: