SCOP 1.69: Domain d1ld4b_: 1ld4 B:

Lineage for d1ld4b_ (1ld4 B:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein Structural proteins [82946] (1 species)

7. Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry)

8. Domain d1ld4b_: 1ld4 B: [77887]

Details for d1ld4b_

PDB Entry: 1ld4

PDB Description: placement of the structural proteins in sindbis virus

SCOP Domain Sequences for d1ld4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ld4b_ i.6.1.1 (B:) Structural proteins {Sindbis virus}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

Timeline for d1ld4b_:

• d1ld4b_ first appeared in SCOP 1.63
  
• d1ld4b_ appears in SCOP 1.67
  
• d1ld4b_ appears in SCOP 1.71
  
• d1ld4b_ appears in the current release, SCOPe 2.08