| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins) |
| Protein Structural proteins [82946] (1 species) |
| Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry) |
| Domain d1ld4b_: 1ld4 B: [77887] |
PDB Entry: 1ld4 (more details)
SCOP Domain Sequences for d1ld4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld4b_ i.6.1.1 (B:) Structural proteins {Sindbis virus}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew
Timeline for d1ld4b_: