SCOPe 2.07: Domain d1lcvb_: 1lcv B:

Lineage for d1lcvb_ (1lcv B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1lcvb_: 1lcv B: [77880]
   complexed with snr

Details for d1lcvb_

PDB Entry: 1lcv, 2.3 Å

PDB Description: streptavidin-norbiotin complex

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1lcvb_:

Sequence; same for both SEQRES and ATOM records:

>d1lcvb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1lcvb_:

• d1lcvb_ first appeared in SCOP 1.63
  
• d1lcvb_ appears in SCOPe 2.06
  
• d1lcvb_ appears in the current release, SCOPe 2.08