Class b: All beta proteins [48724] (141 folds) |
Fold b.61: Streptavidin-like [50875] (6 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) |
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries) |
Domain d1lcvb_: 1lcv B: [77880] complexed with snr |
PDB Entry: 1lcv (more details), 2.3 Å
SCOP Domain Sequences for d1lcvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcvb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii} gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
Timeline for d1lcvb_: