SCOP 1.75: Domain d1lcva_: 1lcv A:

Lineage for d1lcva_ (1lcv A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1lcva_: 1lcv A: [77879]

Details for d1lcva_

PDB Entry: 1lcv, 2.3 Å

PDB Description: streptavidin-norbiotin complex

PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d1lcva_:

Sequence; same for both SEQRES and ATOM records:

>d1lcva_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
p

Timeline for d1lcva_:

• d1lcva_ first appeared in SCOP 1.63
  
• d1lcva_ appears in SCOP 1.73
  
• d1lcva_ appears in SCOPe 2.01
  
• d1lcva_ appears in the current release, SCOPe 2.08