Lineage for d1lbma_ (1lbm A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681489Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 681508Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)
  7. 681511Species Thermotoga maritima [TaxId:2336] [51384] (3 PDB entries)
  8. 681515Domain d1lbma_: 1lbm A: [77876]
    complexed with 137

Details for d1lbma_

PDB Entry: 1lbm (more details), 2.8 Å

PDB Description: crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp)
PDB Compounds: (A:) phosphoribosyl anthranilate isomerase

SCOP Domain Sequences for d1lbma_:

Sequence, based on SEQRES records: (download)

>d1lbma_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf
vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre
fpilldtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvs
sgveafpgkkdhdsikmfiknakgl

Sequence, based on observed residues (ATOM records): (download)

>d1lbma_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf
vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre
fpilldtfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkd
hdsikmfiknakgl

SCOP Domain Coordinates for d1lbma_:

Click to download the PDB-style file with coordinates for d1lbma_.
(The format of our PDB-style files is described here.)

Timeline for d1lbma_: