Lineage for d1lb3a_ (1lb3 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212185Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 212186Protein (Apo)ferritin [47246] (4 species)
  7. 212233Species Mouse (Mus musculus) [TaxId:10090] [63526] (2 PDB entries)
  8. 212234Domain d1lb3a_: 1lb3 A: [77873]
    complexed with cd, cd1, cd3, cd5, gol, so4; mutant

Details for d1lb3a_

PDB Entry: 1lb3 (more details), 1.21 Å

PDB Description: structure of recombinant mouse l chain ferritin at 1.2 a resolution

SCOP Domain Sequences for d1lb3a_:

Sequence, based on SEQRES records: (download)

>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus)}
sqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekreg
aerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsara
dphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk

Sequence, based on observed residues (ATOM records): (download)

>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus)}
sqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekreg
aerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsara
dphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlk

SCOP Domain Coordinates for d1lb3a_:

Click to download the PDB-style file with coordinates for d1lb3a_.
(The format of our PDB-style files is described here.)

Timeline for d1lb3a_: