Lineage for d1lb2e_ (1lb2 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715762Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715763Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2715764Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)
  7. 2715767Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)
  8. 2715769Domain d1lb2e_: 1lb2 E: [77872]
    Other proteins in same PDB: d1lb2a1, d1lb2a2
    protein/DNA complex; protein/RNA complex; complexed with cmp

Details for d1lb2e_

PDB Entry: 1lb2 (more details), 3.1 Å

PDB Description: Structure of the E. coli alpha C-terminal domain of RNA polymerase in complex with CAP and DNA
PDB Compounds: (E:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1lb2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb2e_ a.60.3.1 (E:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
rglslg

SCOPe Domain Coordinates for d1lb2e_:

Click to download the PDB-style file with coordinates for d1lb2e_.
(The format of our PDB-style files is described here.)

Timeline for d1lb2e_: