Lineage for d1lb2b_ (1lb2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1998907Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1998908Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 protein domains)
  6. 1998909Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)
  7. 1998912Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)
  8. 1998913Domain d1lb2b_: 1lb2 B: [77871]
    Other proteins in same PDB: d1lb2a1, d1lb2a2
    protein/DNA complex; protein/RNA complex; complexed with cmp

Details for d1lb2b_

PDB Entry: 1lb2 (more details), 3.1 Å

PDB Description: Structure of the E. coli alpha C-terminal domain of RNA polymerase in complex with CAP and DNA
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1lb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb2b_ a.60.3.1 (B:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
rglslgmrlenw

SCOPe Domain Coordinates for d1lb2b_:

Click to download the PDB-style file with coordinates for d1lb2b_.
(The format of our PDB-style files is described here.)

Timeline for d1lb2b_: