![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
![]() | Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [47792] (2 PDB entries) |
![]() | Domain d1lb2b_: 1lb2 B: [77871] Other proteins in same PDB: d1lb2a1, d1lb2a2 protein/DNA complex; protein/RNA complex; complexed with cmp |
PDB Entry: 1lb2 (more details), 3.1 Å
SCOPe Domain Sequences for d1lb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb2b_ a.60.3.1 (B:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]} dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas rglslgmrlenw
Timeline for d1lb2b_: