Class b: All beta proteins [48724] (119 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (18 proteins) |
Protein TAV coat protein [82011] (1 species) |
Species Tomato aspermy virus [TaxId:12315] [82012] (1 PDB entry) |
Domain d1laja_: 1laj A: [77865] |
PDB Entry: 1laj (more details), 3.4 Å
SCOP Domain Sequences for d1laja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1laja_ b.10.1.2 (A:) TAV coat protein {Tomato aspermy virus} niasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliipvpvseypkkk vscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyqhvptgiqpnn kitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsastlpv
Timeline for d1laja_: