| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
| Domain d1l9tc1: 1l9t C:4-166 [77862] Other proteins in same PDB: d1l9ta2, d1l9tb2, d1l9tc2 complexed with cu, no2 |
PDB Entry: 1l9t (more details), 1.75 Å
SCOPe Domain Sequences for d1l9tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9tc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1l9tc1:
View in 3DDomains from other chains: (mouse over for more information) d1l9ta1, d1l9ta2, d1l9tb1, d1l9tb2 |