SCOP 1.75: Domain d1l9tb2: 1l9t B:167-339

Lineage for d1l9tb2 (1l9t B:167-339)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries)
   Uniprot P38501

8. Domain d1l9tb2: 1l9t B:167-339 [77861]

Details for d1l9tb2

PDB Entry: 1l9t, 1.75 Å

PDB Description: crystal structure of the i257v variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOP Domain Sequences for d1l9tb2:

Sequence; same for both SEQRES and ATOM records:

>d1l9tb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphlvgghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1l9tb2:

• d1l9tb2 first appeared in SCOP 1.63
  
• d1l9tb2 appears in SCOP 1.73
  
• d1l9tb2 appears in SCOPe 2.01
  
• d1l9tb2 appears in the current release, SCOPe 2.08