Lineage for d1l9ra2 (1l9r A:167-339)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224695Family b.6.1.3: Multidomain cupredoxins [49550] (5 protein domains)
  6. 224767Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 224791Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (19 PDB entries)
  8. 224817Domain d1l9ra2: 1l9r A:167-339 [77847]

Details for d1l9ra2

PDB Entry: 1l9r (more details), 1.78 Å

PDB Description: crystal structure of the i257m variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6

SCOP Domain Sequences for d1l9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ra2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphlmgghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOP Domain Coordinates for d1l9ra2:

Click to download the PDB-style file with coordinates for d1l9ra2.
(The format of our PDB-style files is described here.)

Timeline for d1l9ra2: