SCOP 1.63: Domain d1l9pa2: 1l9p A:167-339

Lineage for d1l9pa2 (1l9p A:167-339)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (19 PDB entries)

8. Domain d1l9pa2: 1l9p A:167-339 [77835]

Details for d1l9pa2

PDB Entry: 1l9p, 1.75 Å

PDB Description: crystal structure of nitrite soaked i257g variant of the copper- containing nitrite reductase from alcaligenes faecalies s-6

SCOP Domain Sequences for d1l9pa2:

Sequence; same for both SEQRES and ATOM records:

>d1l9pa2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphlggghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1l9pa2:

• d1l9pa2 is new in SCOP 1.63
  
• d1l9pa2 appears in SCOP 1.65
  
• d1l9pa2 appears in the current release, SCOPe 2.08