Class b: All beta proteins [48724] (119 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) |
Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (19 PDB entries) |
Domain d1l9ob2: 1l9o B:167-339 [77831] |
PDB Entry: 1l9o (more details), 1.7 Å
SCOP Domain Sequences for d1l9ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9ob2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphlagghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1l9ob2:
View in 3D Domains from other chains: (mouse over for more information) d1l9oa1, d1l9oa2, d1l9oc1, d1l9oc2 |