| Class b: All beta proteins [48724] (126 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins) |
| Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries) |
| Domain d1l9ob1: 1l9o B:4-166 [77830] |
PDB Entry: 1l9o (more details), 1.7 Å
SCOP Domain Sequences for d1l9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9ob1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1l9ob1:
View in 3DDomains from other chains: (mouse over for more information) d1l9oa1, d1l9oa2, d1l9oc1, d1l9oc2 |