![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
![]() | Domain d1l9ob1: 1l9o B:4-166 [77830] Other proteins in same PDB: d1l9oa2, d1l9ob2, d1l9oc2 complexed with cu, no2 |
PDB Entry: 1l9o (more details), 1.7 Å
SCOPe Domain Sequences for d1l9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9ob1 b.6.1.3 (B:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1l9ob1:
![]() Domains from other chains: (mouse over for more information) d1l9oa1, d1l9oa2, d1l9oc1, d1l9oc2 |