SCOP 1.75: Domain d1l9eb1: 1l9e B:1-217,B:322-385

Lineage for d1l9eb1 (1l9e B:1-217,B:322-385)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Sarcosine oxidase [51920] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (13 PDB entries)

8. Domain d1l9eb1: 1l9e B:1-217,B:322-385 [77825]
   Other proteins in same PDB: d1l9ea2, d1l9eb2
   complexed with cl, fad, imd

Details for d1l9eb1

PDB Entry: 1l9e, 1.85 Å

PDB Description: role of histidine 269 in catalysis by monomeric sarcosine oxidase

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOP Domain Sequences for d1l9eb1:

Sequence; same for both SEQRES and ATOM records:

>d1l9eb1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

Timeline for d1l9eb1:

• d1l9eb1 first appeared in SCOP 1.63
  
• d1l9eb1 appears in SCOP 1.73
  
• d1l9eb1 appears in SCOPe 2.01
  
• d1l9eb1 appears in the current release, SCOPe 2.08