Lineage for d1l9da1 (1l9d A:1-217,A:322-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849717Protein Sarcosine oxidase [51920] (1 species)
  7. 2849718Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (17 PDB entries)
  8. 2849747Domain d1l9da1: 1l9d A:1-217,A:322-385 [77819]
    Other proteins in same PDB: d1l9da2, d1l9db2
    complexed with cl, fad, pyc

Details for d1l9da1

PDB Entry: 1l9d (more details), 1.95 Å

PDB Description: role of histidine 269 in catalysis by monomeric sarcosine oxidase
PDB Compounds: (A:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d1l9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9da1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOPe Domain Coordinates for d1l9da1:

Click to download the PDB-style file with coordinates for d1l9da1.
(The format of our PDB-style files is described here.)

Timeline for d1l9da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l9da2