Lineage for d1l8qa2 (1l8q A:77-289)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 832094Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 832140Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
    contains TrpR-like DNA-binding domain after the family specific domains
  7. 832141Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries)
  8. 832142Domain d1l8qa2: 1l8q A:77-289 [77810]
    Other proteins in same PDB: d1l8qa1
    complexed with adp, mg, mse

Details for d1l8qa2

PDB Entry: 1l8q (more details), 2.7 Å

PDB Description: crystal structure of dna replication initiation factor
PDB Compounds: (A:) Chromosomal replication initiator protein dnaA

SCOP Domain Sequences for d1l8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk

SCOP Domain Coordinates for d1l8qa2:

Click to download the PDB-style file with coordinates for d1l8qa2.
(The format of our PDB-style files is described here.)

Timeline for d1l8qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l8qa1