Lineage for d1l8qa1 (1l8q A:290-399)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984523Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 1984567Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein)
    monomeric; contains additional N-terminal helices
  6. 1984568Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species)
  7. 1984569Species Aquifex aeolicus [TaxId:63363] [81697] (2 PDB entries)
  8. 1984570Domain d1l8qa1: 1l8q A:290-399 [77809]
    Other proteins in same PDB: d1l8qa2
    complexed with adp, mg

Details for d1l8qa1

PDB Entry: 1l8q (more details), 2.7 Å

PDB Description: crystal structure of dna replication initiation factor
PDB Compounds: (A:) Chromosomal replication initiator protein dnaA

SCOPe Domain Sequences for d1l8qa1:

Sequence, based on SEQRES records: (download)

>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkkdrkfkhlvgflekqafdkic

Sequence, based on observed residues (ATOM records): (download)

>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkrkfkhlvgflekqafdkic

SCOPe Domain Coordinates for d1l8qa1:

Click to download the PDB-style file with coordinates for d1l8qa1.
(The format of our PDB-style files is described here.)

Timeline for d1l8qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l8qa2