Lineage for d1l7xa_ (1l7x A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402819Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 402820Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (7 families) (S)
  5. 402868Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 402869Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 402873Species Human (Homo sapiens) [TaxId:9606] [53768] (8 PDB entries)
  8. 402880Domain d1l7xa_: 1l7x A: [77807]

Details for d1l7xa_

PDB Entry: 1l7x (more details), 2.3 Å

PDB Description: human liver glycogen phosphorylase b complexed with caffeine, n- acetyl-beta-d-glucopyranosylamine, and cp-403,700

SCOP Domain Sequences for d1l7xa_:

Sequence, based on SEQRES records: (download)

>d1l7xa_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens)}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgd
yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrg
agtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlp
ealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinm
ahlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglae
liaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpss
mfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiik
litsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkf
mlngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklv
idqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmv
lkniaasgkfssdrtikeyaqniwnvep

Sequence, based on observed residues (ATOM records): (download)

>d1l7xa_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens)}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndgdyiqavldr
nlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiq
lndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekll
prhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngva
kihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdls
qltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrq
llnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmv
gsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdgan
vemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpd
lfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrt
ikeyaqniwnvep

SCOP Domain Coordinates for d1l7xa_:

Click to download the PDB-style file with coordinates for d1l7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1l7xa_: