Lineage for d1l7wa_ (1l7w A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 251977Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 252009Species Mouse (Mus musculus) [TaxId:10090] [69628] (8 PDB entries)
  8. 252018Domain d1l7wa_: 1l7w A: [77803]
    Other proteins in same PDB: d1l7wb_, d1l7wd_

Details for d1l7wa_

PDB Entry: 1l7w (more details), 2.1 Å

PDB Description: 1:1 complex between alpha-lactalbumin and beta-1,4-galactosyltransferase in the presence of UDP-N-acetylgalactosamine

SCOP Domain Sequences for d1l7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7wa_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1l7wa_:

Click to download the PDB-style file with coordinates for d1l7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1l7wa_:

  • d1l7wa_ is new in SCOP 1.63
  • d1l7wa_ does not appear in SCOP 1.65