SCOP 1.67: Domain d1l7tl2: 1l7t L:113-219

Lineage for d1l7tl2 (1l7t L:113-219)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1l7tl2: 1l7t L:113-219 [77802]
   Other proteins in same PDB: d1l7th1, d1l7th2, d1l7tl1
   part of anti-testosterone Fab 77

Details for d1l7tl2

PDB Entry: 1l7t, 2.1 Å

PDB Description: crystal structure analysis of the anti-testosterone fab fragment

SCOP Domain Sequences for d1l7tl2:

Sequence; same for both SEQRES and ATOM records:

>d1l7tl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrdec

Timeline for d1l7tl2:

• d1l7tl2 first appeared in SCOP 1.63
  
• d1l7tl2 appears in SCOP 1.65
  
• d1l7tl2 appears in SCOP 1.69
  
• d1l7tl2 appears in the current release, SCOPe 2.08