| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Anti-testosterone Fab77, (mouse), kappa L chain [81944] (2 PDB entries) |
| Domain d1l7tl1: 1l7t L:1-112 [77801] Other proteins in same PDB: d1l7th2, d1l7tl2 |
PDB Entry: 1l7t (more details), 2.1 Å
SCOP Domain Sequences for d1l7tl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7tl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-testosterone Fab77, (mouse), kappa L chain}
dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleik
Timeline for d1l7tl1: