SCOP 1.63: Domain d1l7tl1: 1l7t L:1-112

Lineage for d1l7tl1 (1l7t L:1-112)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-testosterone Fab77, (mouse), kappa L chain [81944] (2 PDB entries)

8. Domain d1l7tl1: 1l7t L:1-112 [77801]
   Other proteins in same PDB: d1l7th2, d1l7tl2

Details for d1l7tl1

PDB Entry: 1l7t, 2.1 Å

PDB Description: crystal structure analysis of the anti-testosterone fab fragment

SCOP Domain Sequences for d1l7tl1:

Sequence; same for both SEQRES and ATOM records:

>d1l7tl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-testosterone Fab77, (mouse), kappa L chain}
dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleik

Timeline for d1l7tl1:

• d1l7tl1 is new in SCOP 1.63
  
• d1l7tl1 appears in SCOP 1.65
  
• d1l7tl1 appears in the current release, SCOPe 2.08