SCOP 1.73: Domain d1l7th2: 1l7t H:119-220

Lineage for d1l7th2 (1l7t H:119-220)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1l7th2: 1l7t H:119-220 [77800]
   Other proteins in same PDB: d1l7th1, d1l7tl1, d1l7tl2
   part of anti-testosterone Fab 77

Details for d1l7th2

PDB Entry: 1l7t, 2.1 Å

PDB Description: crystal structure analysis of the anti-testosterone fab fragment

PDB Compounds: (H:) anti-testosterone (heavy chain)

SCOP Domain Sequences for d1l7th2:

Sequence; same for both SEQRES and ATOM records:

>d1l7th2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1l7th2:

• d1l7th2 first appeared in SCOP 1.63
  
• d1l7th2 appears in SCOP 1.71
  
• d1l7th2 appears in SCOP 1.75
  
• d1l7th2 appears in the current release, SCOPe 2.08