SCOP 1.63: Domain d1l7sh2: 1l7s H:119-221

Lineage for d1l7sh2 (1l7s H:119-221)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-testosterone Fab77, (mouse), kappa L chain [81950] (2 PDB entries)

8. Domain d1l7sh2: 1l7s H:119-221 [77796]
   Other proteins in same PDB: d1l7sh1, d1l7sl1

Details for d1l7sh2

PDB Entry: 1l7s, 2.15 Å

PDB Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone

SCOP Domain Sequences for d1l7sh2:

Sequence; same for both SEQRES and ATOM records:

>d1l7sh2 b.1.1.2 (H:119-221) Immunoglobulin (constant domains of L and H chains) {Anti-testosterone Fab77, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

Timeline for d1l7sh2:

• d1l7sh2 is new in SCOP 1.63
  
• d1l7sh2 appears in SCOP 1.65
  
• d1l7sh2 last appears in SCOP 1.69